Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

3,601 – 3,615 of 1,824,772 results

3,601

Invitrogen™ FPR1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P21462, P33766
Isotype	IgG
Concentration	1 mg/mL
Antigen	FPR1
Gene Symbols	FPR1
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	fMet-Leu-Phe receptor; fMLF-R; FMLP; fMLP receptor; formyl peptide receptor 1; FPR; Fpr receptor; FPR1; FPR-1; lipoxin A4 receptor; LXA4R; N-formyl peptide receptor; N-formylpeptide chemoattractant receptor
Gene	FPR1
Product Type	Antibody
Gene ID (Entrez)	14293, 2357
Formulation	PBS with 0.2% BSA, 40% glycerol and 0.05% sodium azide; pH 7.4
Immunogen	Synthetic peptide within Mouse FPR1 aa 171-220/364.
Classification	Polyclonal
Primary or Secondary	Primary

3,602

Invitrogen™ NFkB p65 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Bovine,Canine,Drosophila,Hamster,Human,Mouse,Pig,Rabbit,Rat,Frog
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q04206, Q04207, Q04865
Isotype	IgG
Concentration	1 mg/mL
Antigen	NFkB p65
Gene Symbols	RELA, rela.L
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	avian reticuloendotheliosis viral (v-rel) oncogene homolog A; EBP-1; I79_021812; MGC131774; NF KB; NFkappaB p65; nf-kappa-b p65; NF-kappa-B p65delta3; NF-kappa-B transcription factor p65; NF-kappaB transcription factor p65 subunit; NFkB; NF-kB p65; NF-kB p65 subunit; nfkb rela; NFKB1; nfkb3; NFkB-p50; nuclear factor; nuclear factor kappa b; nuclear factor kappa B subunit p65; nuclear factor NF-kappa-B p65 subunit; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3; p65; p65 NF kappaB; p65 NF-kappa B; p65 NFkB; P65 transcription factor; putative transcription factor p65 homolog; REL A; rel1; rela; RELA proto-oncogene, NF-kB subunit; rela.L; rela-a; Transcription factor p65; v-rel avian reticuloendotheliosis viral oncogene homolog A; v-rel avian reticuloendotheliosis viral oncogene homolog A L homeolog; v-rel reticuloendotheliosis viral oncogene homolog A; v-rel reticuloendotheliosis viral oncogene homolog A (avian); v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65; XELAEV_18022301mg; Xrel1; xrela
Gene	RELA
Product Type	Antibody
Gene ID (Entrez)	100135665, 100763542, 19697, 309165, 394353, 483729, 508233, 5970
Formulation	PBS with 0.05% sodium azide; pH 7.2-7.4
Immunogen	A synthetic peptide from the C-terminus of human NFkappaB protein.
Classification	Polyclonal
Primary or Secondary	Primary

3,603

Invitrogen™ HSP60 Polyclonal Antibody

Chicken Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Chicken
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P10809, P63038, P63039
Isotype	IgY
Concentration	Conc. Not Determined
Antigen	HSP60
Gene Symbols	HSPD1
Regulatory Status	RUO
Gene Alias	60 kDa chaperonin; 60 kDa heat shock protein; 60 kDa heat shock protein, mitochondrial; 60kDa; Chaperonin 60; CPN60; GROEL; heat shock 60kD protein 1 (chaperonin); heat shock 60kDa protein 1; heat shock 60kDa protein 1 (chaperonin); Heat shock protein; heat shock protein 1 (chaperonin); heat shock protein 60; heat shock protein 60 (liver); heat shock protein 65; heat shock protein family D (Hsp60) member 1; heat shock protein, 60 kDa; HLD4; HSP; Hsp60; HSP-60; Hsp60s1; HSP65; HSP-65; Hspd1; Hspd1-30p; HuCHA60; hypothetical protein; I79_011398; mitochondrial matrix protein P1; P1 protein; P60 lymphocyte protein; RCJMB04_7g5; short heat shock protein 60 Hsp60s1; SPG13; Unknown (protein for IMAGE:7943409)
Gene	HSPD1
Product Type	Antibody
Gene ID (Entrez)	15510, 3329, 63868
Formulation	PBS with 0.02% sodium azide
Immunogen	Recombinant full length human HSP60 expressed in and purified from E. coli.
Classification	Polyclonal
Primary or Secondary	Primary

3,604

Invitrogen™ NeuN Polyclonal Antibody

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Goat
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunohistochemistry (PFA fixed),Western Blot,Immunocytochemistry,Multiplex Immunohistochemistry
Form	Liquid
Gene Accession No.	A6NFN3, Q8BIF2
Isotype	IgG
Concentration	1 mg/mL
Antigen	NeuN
Gene Symbols	RBFOX3
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	D11Bwg0517e; FLJ56884; FLJ58356; fox 1 homolog (C. elegans) 3; fox1 homolog C; Fox-1 homolog C; FOX3; FOX-3; FOX3NeuN; hexaribonucleotide binding protein 3; hexaribonucleotide binding protein 3 (HRNBP3); Hexaribonucleotide-binding protein 3; Hrnbp3; NEUN; NeuN antigen; Neuna60; neuronal nuclear antigen A60; neuronal nuclei; Neuronal nuclei antigen; RBFOX3; RFOX3; RGD1560070; RNA binding fox-1 homolog 3; RNA binding protein; RNA binding protein fox-1 homolog 3; RNA binding protein, fox-1 homolog (C. elegans) 3; RNA binding protein, fox-1 homolog 3
Gene	RBFOX3
Product Type	Antibody
Gene ID (Entrez)	146713, 287847, 52897
Formulation	PBS with 50% glycerol and 5mM sodium azide
Immunogen	N-terminal 100 amino acids of human Fox3 expressed in and purified from E. coli.
Classification	Polyclonal
Primary or Secondary	Primary

3,605

Invitrogen™ MMP14 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P50281, P53690, Q10739
Isotype	IgG
Concentration	2 mg/mL
Antigen	MMP14
Gene Symbols	MMP14
Regulatory Status	RUO
Purification Method	Protein A, Antigen affinity chromatography
Gene Alias	AI325305; cb386; EC 3.4.24.80; matrix metallo protease; matrix metallopeptidase 14; matrix metallopeptidase 14 (membrane-inserted); matrix metallopeptidase 14a (membrane-inserted); matrix metalloproteinase 14 (membrane-inserted); matrix metalloproteinase 14 (membrane-inserted) alpha; matrix metalloproteinase 14 membrane-inserted; matrix metalloproteinase 14, membrane-inserted; matrix metalloproteinase 14a (membrane-inserted); matrix metalloproteinase-14; matrix metalloproteinase-14a; membrane type 1 metalloprotease; membrane type 1-matrix metalloproteinase; Membrane type 1-MMP; membrane-type matrix metalloproteinase 1; membrane-type matrix metalloproteinase 1 alpha; membrane-type-1 matrix metalloproteinase; MMP; MMP14; MMP-14; mmp14a; MMPs; MMP-X MT-MMP; MMP-X1; MT1MMP; MT1-MMP; MT1-MMP-alpha; Mtmmp; MT-MMP; MT-MMP 1; MT-MMP MT1-MMP; MTMMP1; MT-MMP-1; MT-MMPalpha; sabe; sb:cb386; type 1 matrix metalloprotease 14; WNCHRS; wu:fb72b09; zMT-MMPalpha; zMT-MMP-alpha
Gene	MMP14
Product Type	Antibody
Gene ID (Entrez)	17387, 4323, 81707
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	KLH conjugated synthetic peptide between 145-174 amino acids from the N-terminal region of human MMP14.
Classification	Polyclonal
Primary or Secondary	Primary

3,606

Invitrogen™ SIRT6 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q8N6T7
Isotype	IgG
Concentration	16 μg/mL
Antigen	SIRT6
Gene Symbols	SIRT6
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	2810449N18Rik; AI043036; NAD-dependent deacetylase sirtuin-6; NAD-dependent protein deacetylase sirtuin-6; Regulatory protein SIR2 homolog 6; SIR2; SIR2 like 6; Sir2l6; SIR2-like protein 6; sir2-related protein type 6; Sirt6; sirtuin 6; sirtuin type 6
Gene	SIRT6
Product Type	Antibody
Gene ID (Entrez)	51548
Formulation	0.01M HEPES with 100μg/mL BSA, 50% glycerol, 0.15M NaCl and no preservative; pH 7.5
Immunogen	Synthetic peptide corresponding to the carboxy terminus of the human SirT6 protein.
Classification	Polyclonal
Primary or Secondary	Primary

3,607

Invitrogen™ COL7A1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	Q02388
Isotype	IgG
Concentration	500 μg/mL
Antigen	COL7A1
Gene Symbols	COL7A1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	alpha-1 type VII collagen; AW209154; COL7A1; collagen alpha-1(VII) chain; collagen type VII alpha 1; collagen type VII alpha 1 chain; collagen vii; collagen VII, alpha-1 polypeptide; collagen, type VII, alpha 1; EBD1; EBDCT; EBR1; HGNC:2214; LC collagen; long chain collagen; long-chain collagen; NDNC8; procollagen, type VII, alpha 1
Gene	COL7A1
Product Type	Antibody
Gene ID (Entrez)	1294
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	E.coli-derived human Collagen VII/COL7A1 recombinant protein (Position: E2764-D2944).
Classification	Polyclonal
Primary or Secondary	Primary

3,608

Invitrogen™ Phospho-MYL9 (Thr18, Ser19) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P24844, Q9CQ19
Isotype	IgG
Concentration	20 μg/mL
Antigen	Phospho-MYL9 (Thr18, Ser19)
Gene Symbols	MYL9
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	20 kDa myosin light chain; AI327049; DTNB; G1; Isoform L20-A; LC20; light polypeptide 9; MGC3505; MLC2; MLC-2; MLC20; MLC-2C; MRLC1; myl9; myl9.L; myl9b; myl9l; Mylc2c; myosin light chain 2; myosin light chain 9; myosin light chain 9 L homeolog; myosin light chain, regulatory C; myosin regulatory light chain; myosin regulatory light chain 1; myosin regulatory light chain 2, smooth muscle isoform; Myosin regulatory light chain 2, smooth muscle major isoform; myosin regulatory light chain 9; Myosin regulatory light chain MRLC1; myosin regulatory light polypeptide 9; myosin regulatory light polypeptide 9b; myosin RLC; myosin, light chain 9, regulatory; myosin, light chain 9b, regulatory; myosin, light polypeptide 9, regulatory; Myrl2; RLC-C; smooth muscle major isoform; unnamed protein product; XELAEV_18003093mg; zgc:77916
Gene	MYL9
Product Type	Antibody
Gene ID (Entrez)	10398, 98932
Formulation	0.01M HEPES with 50% glycerol, 100 μg/mL BSA, 0.15M NaCl and no preservative; pH 7.5
Immunogen	Synthetic phosphopeptide corresponding to residues surrounding pThr18/Ser19 of human myosin light chain 2.
Classification	Polyclonal
Primary or Secondary	Primary

3,609

Invitrogen™ VAV1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Western Blot
Form	Liquid
Gene Accession No.	P15498, P27870, P54100
Isotype	IgG
Concentration	22 μg/mL
Antigen	VAV1
Gene Symbols	VAV1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	oncogene vav; p95; p95vav; Proto-oncogene vav; VAV; vav 1 guanine nucleotide exchange factor; vav 1 oncogene; vav guanine nucleotide exchange factor 1; vav oncogene; vav proto-oncogene; VAV1; vav-T
Gene	VAV1
Product Type	Antibody
Gene ID (Entrez)	22324, 25156, 7409
Formulation	0.01M HEPES with 100μg/mL BSA, 0.15M NaCl, 50% glycerol and no preservative; pH 7.5
Immunogen	Synthetic peptide corresponding to residues surrounding Tyr174 of human Vav.
Classification	Polyclonal
Primary or Secondary	Primary

3,610

Invitrogen™ ITGA7 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry,Western Blot
Form	Liquid
Gene Accession No.	Q13683
Isotype	IgG
Concentration	2 mg/mL
Antigen	ITGA7
Gene Symbols	Itga7
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography, Protein A
Gene Alias	[a]7; alpha 7A integrin; alpha7; H36-alpha7; integrin alpha 7; integrin alpha 7 chain; integrin alpha-7; Integrin alpha-7 70 kDa form; Integrin alpha-7 heavy chain; Integrin alpha-7 light chain; integrin subunit alpha 7; integrin, alpha 7; ITGA7; UNQ406/PRO768
Gene	Itga7
Product Type	Antibody
Gene ID (Entrez)	3679
Formulation	PBS with 0.09% sodium azide; pH 7.4
Immunogen	KLH conjugated synthetic peptide between 247-279 amino acids from the N-terminal region of human ITGA7.
Classification	Polyclonal
Primary or Secondary	Primary

3,611

Invitrogen™ alpha Tubulin Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Canine,Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	A6NHL2, P05213, P0DPH7, P68363, P68366, P68368, P68369, P68370, P68373, Q3KRE8, Q3UX10, Q5XIF6, Q6AYZ1, Q6P9V9, Q6PEY2, Q71U36, Q9BQE3, Q9BVA1, Q9CWF2
Isotype	IgG
Concentration	0.9 mg/mL
Antigen	alpha Tubulin
Gene Symbols	LOC106557476, Tuba1a, Tuba1b, TUBA1C, TUBA3C, TUBA3E, TUBA4A, TUBAL3, TUBB2B
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1t; a1t; ALPHA 84C; alpha tubulin; alpha tubulin 84B; alpha[[1]] tubulin; alpha[[1]]-tubulin; alpha1; alpha1 tubulin; alpha1t; alpha1tub; alpha1tub84B; alpha1-tubulin; alpha84B; alphaT; alphat-1; alphatub; alpha-tub; alphaTub1; alphatub84; alphaTUB84B; alpha-tub84B; alphaTub84B-PA; alphatubulin; alpha-tubulin; Alpha-tubulin 1; Alpha-tubulin 2; Alpha-tubulin 3; Alpha-tubulin 3C; alpha-tubulin 3C/D; Alpha-tubulin 3D; Alpha-tubulin 3E; alpha-tubulin 4; Alpha-tubulin 6; alphaTubulin 84B; alpha-tubulin 84B; alpha-Tubulin at 84B; alpha-tubulin I; Alpha-tubulin II; alpha-tubulin III; Alpha-tubulin isotype M-alpha-1; alpha-tubulin isotype M-alpha-2; Alpha-tubulin isotype M-alpha-4; alpha-tubulin isotype M-alpha-6; alpha-tubulin TUB1; alpha-tubulin ubiquitous; alphaTubulin84B; Alpha-Tubulin84B; ALS22; anon-EST:Liang-1.59; anon-EST:Liang-2.30; AT25469p; aTub84B; a-tub84B; bA408E5.3; B-ALPHA-1; bcm948; BEST:LD32507; cb944; CG1913; CG1913-PA; chr3R:2914276..2914416; clone 1.59; clone 2.30; Detyrosinated tubulin alpha-1A chain; Detyrosinated tubulin alpha-1B chain; Detyrosinated tubulin alpha-1C chain; Detyrosinated tubulin alpha-3 chain; Detyrosinated tubulin alpha-3C chain; Detyrosinated tubulin alpha-3D chain; Detyrosinated tubulin alpha-3E chain; DM1alpha; Dmel\CG1913; Dmel_CG1913; DTA1; fb22g06; FLJ30169; H2 ALPHA; H2-ALPHA; hum-a-tub1; hum-a-tub2; I79_019110; K-ALPHA-1; l(3)84Bd; l(3)g3; lis3; LOC100726777; LOC100731885; LOC100857858; LOC101118307; LOC106557476; M[a]4; M[a]6; ms(3)nc33; nc33; RGD1565476; similar to alpha-tubulin isoform 1; similar to tubulin alpha 1; T; Talpha1; Talpha1 alpha-tubulin; TBA1_DROME; Testis-specific alpha-tubulin; Tub; Tub 84B; TUB1; Tub1C; Tub84B; TUBA1; Tuba-1; tuba1 protein; TUBA1/3/4; Tuba1a; tuba1a.L; tuba1a-a; tuba1a-b; TUBA1B; TUBA1C; tuba1l; tuba1l2; TUBA2; TUBA3; TUBA3C; TUBA3D; TUBA3E; Tuba4; Tuba4a; TUBA5; Tuba6; tuba8.S; tubA84B; tubal2; Tubalpha1; tubulin; tubulin 1 alpha-chain; tubulin 1alpha; tubulin alpha; tubulin alpha 1a; tubulin alpha 1a L homeolog; tubulin alpha 1b; tubulin alpha 1c; tubulin alpha 3; tubulin alpha 3c; tubulin alpha 3e; tubulin alpha 4a; tubulin alpha 6; tubulin alpha 8 S homeolog; tubulin alpha1; tubulin alpha-1 chain; tubulin alpha1 promoter; Tubulin alpha-1A chain; tubulin alpha-1B chain; Tubulin alpha-1C chain; tubulin alpha-1C chain-like; tubulin alpha-2 chain; Tubulin alpha-3 chain; Tubulin alpha-3C chain; tubulin alpha-3C/D chain; Tubulin alpha-3D chain; Tubulin alpha-3E chain; tubulin alpha-4 chain; Tubulin alpha-4A chain; Tubulin alpha-5 chain; tubulin alpha-5 chain-like; tubulin alpha-6 chain; tubulin alpha-8 chain; tubulin alpha-ubiquitous chain; tubulin B-alpha-1; Tubulin H2-alpha; tubulin K-alpha-1; tubulin(alpha1); tubulin, alpha 1; tubulin, alpha 1 (testis specific); tubulin, alpha 1, like; tubulin, alpha 1, like 2; tubulin, alpha 1a; tubulin, alpha 1b; tubulin, alpha 1c; tubulin, alpha 2; tubulin, alpha 3c; tubulin, alpha 3e; tubulin, alpha 4; tubulin, alpha 4a; tubulin, alpha 5; tubulin, alpha 6; tubulin, alpha, brain-specific; tubulin, alpha, ubiquitous; tubulin1alpha; tubulin84B; Tubulin-alpha1; Unknown (protein for MGC:133894); unnamed protein product; wu:fb22g06; wu:fb37a10; XELAEV_18019849mg; XELAEV_18020901mg; YML085C
Gene	TUBAL3
Product Type	Antibody
Gene ID (Entrez)	10376, 106557476, 112714, 22142, 22143, 22145, 22146, 238463, 291081, 291287, 300218, 316531, 347733, 478702, 478918, 487148, 500929, 608138, 608864, 64158, 7277, 7278, 73710, 7846, 79861, 84790
Formulation	PBS with 1% BSA and 0.02% sodium azide; pH 7.4
Immunogen	Synthetic peptide conjugated to KLH derived from within residues 400 to the C-terminus of Human alpha Tubulin.
Classification	Polyclonal
Primary or Secondary	Primary

3,612

Invitrogen™ PACAP-38 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P18509
Isotype	IgG
Concentration	500 μg/mL
Antigen	PACAP-38
Gene Symbols	Adcyap1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	Adcyap1; adenylate cyclase activating polypeptide 1; adenylate cyclase activating polypeptide 1 (pituitary); PACAP; PACAP-27; PACAP-38; PACAP-related peptide; pituitary adenylate cyclase activating polypeptide; pituitary adenylate cyclase activating polypeptide 1; pituitary adenylate cyclase-activating polypeptide; Pituitary adenylate cyclase-activating polypeptide 27; Pituitary adenylate cyclase-activating polypeptide 38; pituitary adenylate cyclase-activating polypeptide precursor (Pacap); prepro-PACAP; PRP-48
Gene	Adcyap1
Product Type	Antibody
Gene ID (Entrez)	116
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence of human PACAP-38/ADCYAP1 (QMAVKKYLAAVLGKRYKQRVK).
Classification	Polyclonal
Primary or Secondary	Primary

3,613

Invitrogen™ Phospho-AMPK alpha-1,2 (Thr172) Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Monkey,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P54645, P54646, Q09137, Q13131, Q5EG47, Q8BRK8
Isotype	IgG
Concentration	83 μg/mL
Antigen	Phospho-AMPK alpha-1,2 (Thr172)
Gene Symbols	PRKAA1, PRKAA2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2310008I11Rik; 5'-AMP-activated protein kinase alpha-1 catalytic subunit; 5'-AMP-activated protein kinase alpha-2 catalytic subunit; 5'-AMP-activated protein kinase catalytic alpha-2 subunit; 5'-AMP-activated protein kinase catalytic subunit alpha-1; 5'-AMP-activated protein kinase catalytic subunit alpha-2; 5'-AMP-activated protein kinase, catalytic alpha-1 chain; 5'-AMP-activated protein kinase, catalytic alpha-2 chain; 63 kDa subunit; A830082D05; AAPK2; ACACA kinase; acetyl-CoA carboxylase kinase; AI194361; AI450832; AL024255; AMP -activate kinase alpha 1 subunit; AMP-activated protein kinase; AMP-activated protein kinase alpha 2; AMP-activated protein kinase alpha-2 subunit variant 2; AMP-activated protein kinase alpha-2 subunit variant 3; AMP-activated protein kinase alpha-2 variant B; AMP-activated protein kinase, alpha 1 catalytic subunit; AMP-activated protein kinase, catalytic, alpha-1; AMPK; AMPK 63 kDa subunit; AMPK alpha 1; AMPK alpha 2; AMPK alpha-1 chain; AMPK alpha-2 chain; AMPK subunit alpha-1; AMPK subunit alpha-2; AMPK1; AMPK2; AMPKa1; AMPKa2; AMPK-activated protein kinase alpha-2 subunit; AMPKalpha1; AMPK-alpha-1 chain; AMPKalpha2; AMPK-alpha-2 chain; C130083N04Rik; HMGCR kinase; hydroxymethylglutaryl-CoA reductase kinase; pAMPK; PRKAA; Prkaa1; Prkaa2; protein kinase; protein kinase AMP-activated alpha 2 catalytic subunit; protein kinase AMP-activated catalytic subunit alpha 1; protein kinase AMP-activated catalytic subunit alpha 2; protein kinase, AMP-activated, alpha 1 catalytic subunit; protein kinase, AMP-activated, alpha 2 catalytic subunit; tau-protein kinase PRKAA1
Gene	PRKAA2
Product Type	Antibody
Gene ID (Entrez)	105787, 108079, 5562, 5563, 65248, 78975
Formulation	0.01M HEPES with 0.15M NaCl, 50% glycerol, 100μg/mL BSA and no preservative; pH 7.5
Immunogen	Synthetic phosphopeptide corresponding to residues surrounding Thr172 of human AMPKa.
Classification	Polyclonal
Primary or Secondary	Primary

3,614

Invitrogen™ EpCAM Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C or -80°C if preferred
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O55159, P16422, Q99JW5
Isotype	IgG
Concentration	0.9 mg/mL
Antigen	EpCAM
Gene Symbols	EPCAM
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	adenocarcinoma-associated antigen; CD326; cell surface glycoprotein Trop-1; DIAR5; EGP; EGP-2; EGP314; EGP40; EPCAM; Ep-CAM; EpCAM1; epithelial cell adhesion molecule; Epithelial cell surface antigen; Epithelial glycoprotein; Epithelial glycoprotein 314; ESA; GA733-2; gp40; hEGP314; HNPCC8; human epithelial glycoprotein-2; KS 1/4 antigen; KS1/4; KSA; Ly74; lymphocyte antigen 74; M1S2; M4S1; major gastrointestinal tumor-associated protein GA733-2; mEGP314; membrane component, chromosome 4, surface marker (35kD glycoprotein); MIC18; MK-1; panepithelial glycoprotein 314; protein 289A; Protein D5.7A; Tacsd1; Tacstd1; TROP1; Trop-1 protein; Tumor-associated calcium signal transducer 1
Gene	EPCAM
Product Type	Antibody
Gene ID (Entrez)	17075, 171577, 4072
Formulation	PBS with 1% BSA and 0.02% sodium azide; pH 7.4
Immunogen	Synthetic peptide conjugated to KLH derived from within residues 250 to the C-terminus of Human CD326 / EpCAM / Epithelial Specific Antigen.
Classification	Polyclonal
Primary or Secondary	Primary

3,615

Invitrogen™ SLC34A2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	O95436, Q9DBP0, Q9JJ09
Isotype	IgG
Concentration	500 μg/mL
Antigen	SLC34A2
Gene Symbols	SLC34A2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AA536683; D5Ertd227e; Na(+)/Pi cotransporter 2B; Na(+)-dependent phosphate cotransporter 2B; NAPI IIb; NaPi-2b; NaPi3b; NAPI-3B; NAPI-IIb; Npt2b; NPTIIb; rNaPi IIb; Slc34a2; Sodium/phosphate cotransporter 2B; Sodium-dependent phosphate transport protein 2B; sodium-phosphate transport protein 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate contransporter), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; solute carrier family 34 member 2; type II sodium-dependent phosphate transporter 3b; type IIb Na/Picotransporter; type IIb sodium-phosphate transporter
Gene	SLC34A2
Product Type	Antibody
Gene ID (Entrez)	10568, 20531, 84395
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
Classification	Polyclonal
Primary or Secondary	Primary

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ FPR1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HSP60 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NeuN Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MMP14 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SIRT6 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ COL7A1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-MYL9 (Thr18, Ser19) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VAV1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ITGA7 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ alpha Tubulin Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ PACAP-38 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-AMPK alpha-1,2 (Thr172) Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ EpCAM Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SLC34A2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ FPR1 Polyclonal Antibody

Invitrogen™ HSP60 Polyclonal Antibody

Invitrogen™ NeuN Polyclonal Antibody

Invitrogen™ MMP14 Polyclonal Antibody

Invitrogen™ SIRT6 Polyclonal Antibody

Invitrogen™ COL7A1 Polyclonal Antibody

Invitrogen™ Phospho-MYL9 (Thr18, Ser19) Polyclonal Antibody

Invitrogen™ VAV1 Polyclonal Antibody

Invitrogen™ ITGA7 Polyclonal Antibody

Invitrogen™ alpha Tubulin Polyclonal Antibody

Invitrogen™ PACAP-38 Polyclonal Antibody

Invitrogen™ Phospho-AMPK alpha-1,2 (Thr172) Polyclonal Antibody

Invitrogen™ EpCAM Polyclonal Antibody

Invitrogen™ SLC34A2 Polyclonal Antibody